![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.194: L27 domain [101287] (1 superfamily) 6 helices, heterodimer of 3-helical domains |
![]() | Superfamily a.194.1: L27 domain [101288] (1 family) ![]() |
![]() | Family a.194.1.1: L27 domain [101289] (4 proteins) |
![]() | Protein Presynaptic protein sap97 [101294] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [101295] (1 PDB entry) |
![]() | Domain d1rsoa_: 1rso A: [97811] Other proteins in same PDB: d1rsob_, d1rsod_ |
PDB Entry: 1rso (more details)
SCOP Domain Sequences for d1rsoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rsoa_ a.194.1.1 (A:) Presynaptic protein sap97 {Rat (Rattus norvegicus)} rkqdtqralhlleeyrsklsqtedrqlrssiervisifqsnlfqalidiqefyevtlldn
Timeline for d1rsoa_: