Lineage for d1rrsa1 (1rrs A:9-230)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720979Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2720980Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2720988Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins)
  6. 2720989Protein Catalytic domain of MutY [48155] (2 species)
  7. 2720990Species Bacillus stearothermophilus [TaxId:1422] [101348] (5 PDB entries)
  8. 2720992Domain d1rrsa1: 1rrs A:9-230 [97800]
    Other proteins in same PDB: d1rrsa2
    protein/DNA complex; complexed with ca, sf4

Details for d1rrsa1

PDB Entry: 1rrs (more details), 2.4 Å

PDB Description: MutY adenine glycosylase in complex with DNA containing an abasic site
PDB Compounds: (A:) MutY

SCOPe Domain Sequences for d1rrsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrsa1 a.96.1.2 (A:9-230) Catalytic domain of MutY {Bacillus stearothermophilus [TaxId: 1422]}
parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl
ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv
gavlslaygvpepavngnvmrvlsrlflvtddiakpstrkrfeqivreimayenpgafne
alielgalvctprrpscllcpvqaycqafaegvaeelpvkmk

SCOPe Domain Coordinates for d1rrsa1:

Click to download the PDB-style file with coordinates for d1rrsa1.
(The format of our PDB-style files is described here.)

Timeline for d1rrsa1: