SCOPe 2.03: Domain d1rqra2: 1rqr A:8-192

Lineage for d1rqra2 (1rqr A:8-192)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold

4. Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families)

5. Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (1 protein)

6. Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species)

7. Species Streptomyces cattleya [TaxId:29303] [102525] (14 PDB entries)

8. Domain d1rqra2: 1rqr A:8-192 [97765]
   Other proteins in same PDB: d1rqra1, d1rqrb1, d1rqrc1
   complexed with 5fd, met

Details for d1rqra2

PDB Entry: 1rqr, 2.67 Å

PDB Description: crystal structure and mechanism of a bacterial fluorinating enzyme, product complex

PDB Compounds: (A:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d1rqra2:

Sequence; same for both SEQRES and ATOM records:

>d1rqra2 c.132.1.1 (A:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr

Timeline for d1rqra2:

• d1rqra2 first appeared in SCOP 1.67
  
• d1rqra2 appears in SCOPe 2.02
  
• d1rqra2 appears in SCOPe 2.04
  
• d1rqra2 appears in the current release, SCOPe 2.08