SCOPe 2.03: Domain d1rqra1: 1rqr A:193-298

Lineage for d1rqra1 (1rqr A:193-298)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
   barrel, closed; n=7, S=10; greek-key topology; one overside connection

4. Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families)

5. Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein)

6. Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species)

7. Species Streptomyces cattleya [TaxId:29303] [101855] (14 PDB entries)

8. Domain d1rqra1: 1rqr A:193-298 [97764]
   Other proteins in same PDB: d1rqra2, d1rqrb2, d1rqrc2
   complexed with 5fd, met

Details for d1rqra1

PDB Entry: 1rqr, 2.67 Å

PDB Description: crystal structure and mechanism of a bacterial fluorinating enzyme, product complex

PDB Compounds: (A:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d1rqra1:

Sequence; same for both SEQRES and ATOM records:

>d1rqra1 b.141.1.1 (A:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

Timeline for d1rqra1:

• d1rqra1 first appeared in SCOP 1.67
  
• d1rqra1 appears in SCOPe 2.02
  
• d1rqra1 appears in SCOPe 2.04
  
• d1rqra1 appears in the current release, SCOPe 2.08