SCOP 1.67: Domain d1rqla_: 1rql A:

Lineage for d1rqla_ (1rql A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (14 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.3: Phosphonoacetaldehyde hydrolase [56792] (1 protein)
   the insertion subdomain is a 4-helical bundle

6. Protein Phosphonoacetaldehyde hydrolase [56793] (1 species)

7. Species Bacillus cereus [TaxId:1396] [56794] (3 PDB entries)

8. Domain d1rqla_: 1rql A: [97750]

Details for d1rqla_

PDB Entry: 1rql, 2.4 Å

PDB Description: Crystal Structure of Phosponoacetaldehyde Hydrolase Complexed with Magnesium and the Inhibitor Vinyl Sulfonate

SCOP Domain Sequences for d1rqla_:

Sequence; same for both SEQRES and ATOM records:

>d1rqla_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus}
kieavifdwagttvdygcfaplevfmeifhkrgvaitaeearkpmgllkidhvraltemp
riasewnrvfrqlpteadiqemyeefeeilfailpryaspinavkeviaslrergikigs
ttgytremmdivakeaalqgykpdflvtpddvpagrpypwmcyknamelgvypmnhmikv
gdtvsdmkegrnagmwtvgvilgsselglteeevenmdsvelrekievvrnrfvengahf
tietmqelesvmehiek

Timeline for d1rqla_:

• d1rqla_ is new in SCOP 1.67
  
• d1rqla_ appears in SCOP 1.69
  
• d1rqla_ appears in the current release, SCOPe 2.08