SCOP 1.67: Domain d1rqib_: 1rqi B:

Lineage for d1rqib_ (1rqi B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (5 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (2 proteins)

6. Protein Farnesyl diphosphate synthase (geranyltranstransferase) [48578] (3 species)

7. Species Escherichia coli [TaxId:562] [101453] (2 PDB entries)

8. Domain d1rqib_: 1rqi B: [97743]
   complexed with dpo, dst, ipr, mg

Details for d1rqib_

PDB Entry: 1rqi, 2.42 Å

PDB Description: active conformation of farnesyl pyrophosphate synthase bound to isopentyl pyrophosphate and dimethylallyl s-thiolodiphosphate

SCOP Domain Sequences for d1rqib_:

Sequence; same for both SEQRES and ATOM records:

>d1rqib_ a.128.1.1 (B:) Farnesyl diphosphate synthase (geranyltranstransferase) {Escherichia coli}
dfpqqleacvkqanqalsrfiaplpfqntpvvetmqygallggkrlrpflvyatghmfgv
stntldapaaavecihayslihddlpamddddlrrglptchvkfgeanailagdalqtla
fsilsdadmpevsdrdrismiselasasgiagmcggqaldldaegkhvpldalerihrhk
tgaliraavrlgalsagdkgrralpvldkyaesiglafqvqddildvvgdtatlgkrqga
dqqlgkstypallgleqarkkardliddarqslkqlaeqsldtsalealadyiiqrnk

Timeline for d1rqib_:

• d1rqib_ is new in SCOP 1.67
  
• d1rqib_ appears in SCOP 1.69
  
• d1rqib_ appears in the current release, SCOPe 2.08