Lineage for d1rp5a3 (1rp5 A:64-263)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1227704Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 1227705Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (1 family) (S)
  5. 1227706Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
    contains an insert subdomain of ClpS-like fold
  6. 1227719Protein Penicillin-binding protein 2x (pbp-2x), N-terminal domain [56521] (1 species)
    the insert subdomain (residues 93-183) is usually disordered in the structures
  7. 1227720Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [56522] (6 PDB entries)
  8. 1227724Domain d1rp5a3: 1rp5 A:64-263 [97696]
    Other proteins in same PDB: d1rp5a1, d1rp5a2, d1rp5a4, d1rp5b1, d1rp5b2, d1rp5b4
    the insert subdomain is fully ordered
    complexed with so4

Details for d1rp5a3

PDB Entry: 1rp5 (more details), 3 Å

PDB Description: PBP2x from Streptococcus pneumoniae strain 5259 with reduced susceptibility to beta-lactam antibiotics
PDB Compounds: (A:) penicillin-binding protein 2x

SCOPe Domain Sequences for d1rp5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rp5a3 d.175.1.1 (A:64-263) Penicillin-binding protein 2x (pbp-2x), N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
kvhqttrtvpakrgtiydrngvpiaedatsynvyavidenyksatgkilyvektqfnkva
evfhkyldmeesyvreqlsqpnlkqvsfgakgngityanmmsikkeletaevkgidftts
pnrsypngqfassfiglaqlhenedgsksllgtsgmesslnsilagtdgiityekdrlgn
ivpgteqvsqqtvdgkdvyt

SCOPe Domain Coordinates for d1rp5a3:

Click to download the PDB-style file with coordinates for d1rp5a3.
(The format of our PDB-style files is described here.)

Timeline for d1rp5a3: