Class a: All alpha proteins [46456] (284 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) |
Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins) possible duplication: contains several domains of this fold The listed PDB entries contain different large fragments but not the whole proteins |
Protein Vinculin [47224] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [101111] (3 PDB entries) Uniprot P18206 1-257 |
Domain d1rkca1: 1rkc A:1-128 [97606] head domain; contains two domains of this fold; complexed with talin fragment, chain B |
PDB Entry: 1rkc (more details), 2.7 Å
SCOPe Domain Sequences for d1rkca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rkca1 a.24.9.1 (A:1-128) Vinculin {Human (Homo sapiens) [TaxId: 9606]} mpvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvaavqaavsnlvrvgke tvqttedqilkrdmppafikvenactklvqaaqmlqsdpysvpardylidgsrgilsgts dllltfde
Timeline for d1rkca1: