Lineage for d1rk4a1 (1rk4 A:92-234)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1089232Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1089233Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1089234Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 1089235Protein Chloride intracellular channel 1 (clic1) [69033] (1 species)
    similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition
  7. 1089236Species Human (Homo sapiens) [TaxId:9606] [69034] (4 PDB entries)
  8. 1089239Domain d1rk4a1: 1rk4 A:92-234 [97592]
    Other proteins in same PDB: d1rk4a2, d1rk4b2
    oxidized form; N-domain adopts a different all-alpha dimeric fold

Details for d1rk4a1

PDB Entry: 1rk4 (more details), 1.79 Å

PDB Description: Crystal Structure of a Soluble Dimeric Form of Oxidised CLIC1
PDB Compounds: (A:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d1rk4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rk4a1 a.45.1.1 (A:92-234) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielaye

SCOPe Domain Coordinates for d1rk4a1:

Click to download the PDB-style file with coordinates for d1rk4a1.
(The format of our PDB-style files is described here.)

Timeline for d1rk4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rk4a2