Lineage for d1rj7l_ (1rj7 L:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793598Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 793599Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 793600Family b.22.1.1: TNF-like [49843] (14 proteins)
  6. 793667Protein Ectodysplasin A, Eda-a1 [101610] (1 species)
  7. 793668Species Human (Homo sapiens) [TaxId:9606] [101611] (2 PDB entries)
  8. 793685Domain d1rj7l_: 1rj7 L: [97545]

Details for d1rj7l_

PDB Entry: 1rj7 (more details), 2.3 Å

PDB Description: crystal structure of eda-a1
PDB Compounds: (L:) Ectodysplasin A

SCOP Domain Sequences for d1rj7l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj7l_ b.22.1.1 (L:) Ectodysplasin A, Eda-a1 {Human (Homo sapiens) [TaxId: 9606]}
nqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiys
qvevyyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmv
hadisinmskhttffgairlgeapa

SCOP Domain Coordinates for d1rj7l_:

Click to download the PDB-style file with coordinates for d1rj7l_.
(The format of our PDB-style files is described here.)

Timeline for d1rj7l_: