SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1rj7l_ (1rj7 L:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041369Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2041370Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2041371Family b.22.1.1: TNF-like [49843] (15 protein domains)
  6. 2041446Protein Ectodysplasin A, Eda-a1 [101610] (1 species)
  7. 2041447Species Human (Homo sapiens) [TaxId:9606] [101611] (2 PDB entries)
  8. 2041464Domain d1rj7l_: 1rj7 L: [97545]

Details for d1rj7l_

PDB Entry: 1rj7 (more details), 2.3 Å

PDB Description: Crystal structure of EDA-A1
PDB Compounds: (L:) Ectodysplasin A

SCOPe Domain Sequences for d1rj7l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj7l_ b.22.1.1 (L:) Ectodysplasin A, Eda-a1 {Human (Homo sapiens) [TaxId: 9606]}
nqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiys
qvevyyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmv
hadisinmskhttffgairlgeapa

SCOPe Domain Coordinates for d1rj7l_:

Click to download the PDB-style file with coordinates for d1rj7l_.
(The format of our PDB-style files is described here.)

Timeline for d1rj7l_: