Lineage for d1rj4c_ (1rj4 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2322003Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (2 families) (S)
    contains a short alpha-hairpin at the N-terminal extension
  5. 2322004Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (3 proteins)
    Pfam PF04043
  6. 2322005Protein Invertase inhibitor [101150] (1 species)
  7. 2322006Species Tobacco (Nicotiana tabacum) [TaxId:4097] [101151] (2 PDB entries)
  8. 2322010Domain d1rj4c_: 1rj4 C: [97529]
    complexed with btb, cd

Details for d1rj4c_

PDB Entry: 1rj4 (more details), 2 Å

PDB Description: Structure of a Cell Wall Invertase Inhibitor from Tobacco in Complex with Cd2+
PDB Compounds: (C:) invertase inhibitor

SCOPe Domain Sequences for d1rj4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj4c_ a.29.6.1 (C:) Invertase inhibitor {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
nlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhsn
ppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkgs
kspfsalniavhelsdvgraivrnll

SCOPe Domain Coordinates for d1rj4c_:

Click to download the PDB-style file with coordinates for d1rj4c_.
(The format of our PDB-style files is described here.)

Timeline for d1rj4c_: