| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
| Family a.35.1.2: Phage repressors [47419] (7 proteins) consists of different sequence families of HTH repressors of phage origins |
| Protein lambda C1 repressor, DNA-binding domain [47420] (1 species) |
| Species Bacteriophage lambda [TaxId:10710] [47421] (5 PDB entries) |
| Domain d1riob_: 1rio B: [97514] Other proteins in same PDB: d1rioh_ protein/DNA complex; complexed with ca, mpd |
PDB Entry: 1rio (more details), 2.3 Å
SCOPe Domain Sequences for d1riob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1riob_ a.35.1.2 (B:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]}
stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
naallakilkvsveefspsiareiyemyeavhhhhh
Timeline for d1riob_: