Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) consists of clearly related families of somewhat different folds |
Family c.1.16.3: F420 dependent oxidoreductases [51687] (2 proteins) automatically mapped to Pfam PF00296 |
Protein Coenzyme F420 dependent secondary alcohol dehydrogenase [102101] (1 species) |
Species Methanoculleus thermophilicus [TaxId:2200] [102102] (1 PDB entry) |
Domain d1rhca_: 1rhc A: [97468] complexed with acn, cl, f42, k |
PDB Entry: 1rhc (more details), 1.8 Å
SCOPe Domain Sequences for d1rhca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rhca_ c.1.16.3 (A:) Coenzyme F420 dependent secondary alcohol dehydrogenase {Methanoculleus thermophilicus [TaxId: 2200]} mktqigyfasleqyrpmdaleqairaekvgfdsvwvddhfhpwyhdnaqsaqawawmgaa lqatkkvfistcitcpimrynpaivaqtfatlrqmypgrvgvavgageamnevpvtgewp svpvrqdmtveavkvmrmlwesdkpvtfkgdyftldkaflytkpddevplyfsgmgpkga klagmygdhlmtvaaapstlknvtipkfeegareagkdpskmehamliwysvdpdydkav ealrfwagclvpsmfkykvydpkevqlhanlvhcdtikenymcatdaeemikeierfkea ginhfclgnsspdvnfgidifkevipavrd
Timeline for d1rhca_: