Lineage for d1rhca_ (1rhc A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839499Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2839536Family c.1.16.3: F420 dependent oxidoreductases [51687] (2 proteins)
    automatically mapped to Pfam PF00296
  6. 2839537Protein Coenzyme F420 dependent secondary alcohol dehydrogenase [102101] (1 species)
  7. 2839538Species Methanoculleus thermophilicus [TaxId:2200] [102102] (1 PDB entry)
  8. 2839539Domain d1rhca_: 1rhc A: [97468]
    complexed with acn, cl, f42, k

Details for d1rhca_

PDB Entry: 1rhc (more details), 1.8 Å

PDB Description: F420-dependent secondary alcohol dehydrogenase in complex with an F420-acetone adduct
PDB Compounds: (A:) F420-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1rhca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhca_ c.1.16.3 (A:) Coenzyme F420 dependent secondary alcohol dehydrogenase {Methanoculleus thermophilicus [TaxId: 2200]}
mktqigyfasleqyrpmdaleqairaekvgfdsvwvddhfhpwyhdnaqsaqawawmgaa
lqatkkvfistcitcpimrynpaivaqtfatlrqmypgrvgvavgageamnevpvtgewp
svpvrqdmtveavkvmrmlwesdkpvtfkgdyftldkaflytkpddevplyfsgmgpkga
klagmygdhlmtvaaapstlknvtipkfeegareagkdpskmehamliwysvdpdydkav
ealrfwagclvpsmfkykvydpkevqlhanlvhcdtikenymcatdaeemikeierfkea
ginhfclgnsspdvnfgidifkevipavrd

SCOPe Domain Coordinates for d1rhca_:

Click to download the PDB-style file with coordinates for d1rhca_.
(The format of our PDB-style files is described here.)

Timeline for d1rhca_: