PDB entry 1rhc

View 1rhc on RCSB PDB site
Description: F420-dependent secondary alcohol dehydrogenase in complex with an F420-acetone adduct
Class: oxidoreductase
Keywords: (alpha, beta)8 barrel, OXIDOREDUCTASE
Deposited on 2003-11-14, released 2004-03-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.158
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F420-dependent alcohol dehydrogenase
    Species: Methanoculleus thermophilus [TaxId:2200]
    Database cross-references and differences (RAF-indexed):
    • GB CAA77275 (0-329)
    Domains in SCOPe 2.08: d1rhca_
  • Heterogens: CL, K, F42, ACN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rhcA (A:)
    mktqigyfasleqyrpmdaleqairaekvgfdsvwvddhfhpwyhdnaqsaqawawmgaa
    lqatkkvfistcitcpimrynpaivaqtfatlrqmypgrvgvavgageamnevpvtgewp
    svpvrqdmtveavkvmrmlwesdkpvtfkgdyftldkaflytkpddevplyfsgmgpkga
    klagmygdhlmtvaaapstlknvtipkfeegareagkdpskmehamliwysvdpdydkav
    ealrfwagclvpsmfkykvydpkevqlhanlvhcdtikenymcatdaeemikeierfkea
    ginhfclgnsspdvnfgidifkevipavrd