Lineage for d1rgza_ (1rgz A:)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 617469Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 617470Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 617471Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (13 proteins)
  6. 617472Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 617479Species Enterobacter cloacae, P99, cephalosporinase [TaxId:550] [56620] (8 PDB entries)
  8. 617481Domain d1rgza_: 1rgz A: [97457]
    complexed with gol, ptx

Details for d1rgza_

PDB Entry: 1rgz (more details), 1.37 Å

PDB Description: Enterobacter cloacae GC1 Class C beta-Lactamase Complexed with Transition-State Analog of Cefotaxime

SCOP Domain Sequences for d1rgza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgza_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase}
pvsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
lgsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplqv
pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
lkldhtwinvpkaeeahyawgyrdgkavravrvspgmldaqaygvktnvqdmanwvmanm
apenvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpv
aevnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhile
alq

SCOP Domain Coordinates for d1rgza_:

Click to download the PDB-style file with coordinates for d1rgza_.
(The format of our PDB-style files is described here.)

Timeline for d1rgza_: