Lineage for d1rgwa_ (1rgw A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1312126Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1312127Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1312128Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1312417Protein Zasp (Cypher, Oracle 1) [101735] (2 species)
  7. 1312418Species Human (Homo sapiens) [TaxId:9606] [101736] (1 PDB entry)
  8. 1312419Domain d1rgwa_: 1rgw A: [97455]

Details for d1rgwa_

PDB Entry: 1rgw (more details)

PDB Description: solution structure of zasp's pdz domain
PDB Compounds: (A:) ZASP protein

SCOPe Domain Sequences for d1rgwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]}
maysvtltgpgpwgfrlqggkdfnmpltisritpgskaaqsqlsqgdlvvaidgvntdtm
thleaqnkiksasynlsltlqkskr

SCOPe Domain Coordinates for d1rgwa_:

Click to download the PDB-style file with coordinates for d1rgwa_.
(The format of our PDB-style files is described here.)

Timeline for d1rgwa_: