Lineage for d1rgwa_ (1rgw A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373409Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 373410Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 373411Family b.36.1.1: PDZ domain [50157] (24 proteins)
  6. 373535Protein Zasp, PDZ domain [101735] (1 species)
  7. 373536Species Human (Homo sapiens) [TaxId:9606] [101736] (1 PDB entry)
  8. 373537Domain d1rgwa_: 1rgw A: [97455]
    mutant

Details for d1rgwa_

PDB Entry: 1rgw (more details)

PDB Description: solution structure of zasp's pdz domain

SCOP Domain Sequences for d1rgwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgwa_ b.36.1.1 (A:) Zasp, PDZ domain {Human (Homo sapiens)}
maysvtltgpgpwgfrlqggkdfnmpltisritpgskaaqsqlsqgdlvvaidgvntdtm
thleaqnkiksasynlsltlqkskr

SCOP Domain Coordinates for d1rgwa_:

Click to download the PDB-style file with coordinates for d1rgwa_.
(The format of our PDB-style files is described here.)

Timeline for d1rgwa_: