SCOP 1.67: Domain d1rgua1: 1rgu A:162-350

Lineage for d1rgua1 (1rgu A:162-350)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
   beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234

4. Superfamily d.136.1: Phospholipase D/nuclease [56024] (3 families)

5. Family d.136.1.3: Tyrosyl-DNA phosphodiesterase TDP1 [69815] (1 protein)

6. Protein Tyrosyl-DNA phosphodiesterase TDP1 [69816] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69817] (12 PDB entries)

8. Domain d1rgua1: 1rgu A:162-350 [97450]

Details for d1rgua1

PDB Entry: 1rgu, 2.22 Å

PDB Description: the crystal structure of human tyrosyl-dna phosphodiesterase complexed with vanadate, octopamine, and tetranucleotide agtg

SCOP Domain Sequences for d1rgua1:

Sequence; same for both SEQRES and ATOM records:

>d1rgua1 d.136.1.3 (A:162-350) Tyrosyl-DNA phosphodiesterase TDP1 {Human (Homo sapiens)}
npfqfyltrvsgvkpkynsgalhikdilsplfgtlvssaqfnycfdvdwlvkqyppefrk
kpillvhgdkreakahlhaqakpyenislcqakldiafgthhtkmmlllyeeglrvviht
snlihadwhqktqgiwlsplypriadgthksgespthfkanlisyltaynapslkewidv
ihkhdlset

Timeline for d1rgua1:

• d1rgua1 is new in SCOP 1.67
  
• d1rgua1 appears in SCOP 1.69
  
• d1rgua1 appears in the current release, SCOPe 2.08