![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.195: YutG-like [101306] (1 superfamily) core: 6 helices; bundle; one central helix is surrounded by 5 others |
![]() | Superfamily a.195.1: YutG-like [101307] (1 family) ![]() |
![]() | Family a.195.1.1: YutG-like [101308] (3 proteins) Pfam PF01892; DUF64 |
![]() | Protein YutG homologue [101309] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [101310] (1 PDB entry) |
![]() | Domain d1rfzd_: 1rfz D: [97414] structural genomics; MCSG target APC35681 complexed with so4 |
PDB Entry: 1rfz (more details), 2.8 Å
SCOP Domain Sequences for d1rfzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rfzd_ a.195.1.1 (D:) YutG homologue {Bacillus stearothermophilus [TaxId: 1422]} nleqtarrwleergvtvekiaelvyylqskyhpdltmeecienvnrviskrevqnailtg iqldklaedgrldeplqsiirrdeglygvdeilalsivnvygsigftnygyidkqkpgil qylndkstgkcntflddivgaiaaaassrlahra
Timeline for d1rfzd_: