Lineage for d1rfza_ (1rfz A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780020Fold a.195: YutG-like [101306] (1 superfamily)
    core: 6 helices; bundle; one central helix is surrounded by 5 others
  4. 780021Superfamily a.195.1: YutG-like [101307] (1 family) (S)
  5. 780022Family a.195.1.1: YutG-like [101308] (3 proteins)
    Pfam PF01892; DUF64
  6. 780032Protein YutG homologue [101309] (1 species)
  7. 780033Species Bacillus stearothermophilus [TaxId:1422] [101310] (1 PDB entry)
  8. 780034Domain d1rfza_: 1rfz A: [97411]
    structural genomics; MCSG target APC35681

Details for d1rfza_

PDB Entry: 1rfz (more details), 2.8 Å

PDB Description: Structure of Protein of Unknown Function from Bacillus stearothermophilus
PDB Compounds: (A:) Hypothetical protein APC35681

SCOP Domain Sequences for d1rfza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rfza_ a.195.1.1 (A:) YutG homologue {Bacillus stearothermophilus [TaxId: 1422]}
snamsefimnnleqtarrwleergvtvekiaelvyylqskyhpdltmeecienvnrvisk
revqnailtgiqldklaedgrldeplqsiirrdeglygvdeilalsivnvygsigftnyg
yidkqkpgilqylndkstgkcntflddivgaiaaaassrlahra

SCOP Domain Coordinates for d1rfza_:

Click to download the PDB-style file with coordinates for d1rfza_.
(The format of our PDB-style files is described here.)

Timeline for d1rfza_: