SCOPe 2.06: Domain d1rf0b2: 1rf0 B:154-199

Lineage for d1rf0b2 (1rf0 B:154-199)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen beta chain [88892] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries)
   Uniprot P02675

8. Domain d1rf0b2: 1rf0 B:154-199 [97340]
   Other proteins in same PDB: d1rf0a_, d1rf0b1, d1rf0c1, d1rf0c2, d1rf0d_, d1rf0e1, d1rf0f1, d1rf0f2
   coiled-coil region only
   complexed with ca, nag

Details for d1rf0b2

PDB Entry: 1rf0, 2.81 Å

PDB Description: crystal structure of fragment d of gammae132a fibrinogen

PDB Compounds: (B:) fibrinogen beta chain

SCOPe Domain Sequences for d1rf0b2:

Sequence; same for both SEQRES and ATOM records:

>d1rf0b2 h.1.8.1 (B:154-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]}
detvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv

Timeline for d1rf0b2:

• d1rf0b2 first appeared in SCOP 1.67
  
• d1rf0b2 appears in SCOPe 2.05
  
• d1rf0b2 appears in SCOPe 2.07
  
• d1rf0b2 appears in the current release, SCOPe 2.08