SCOP 1.73: Domain d1rb7b_: 1rb7 B:

Lineage for d1rb7b_ (1rb7 B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (4 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (7 proteins)
   strand 5 is parallel to strand 4

6. Protein Cytosine deaminase [89801] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89802] (6 PDB entries)

8. Domain d1rb7b_: 1rb7 B: [97278]
   complexed with zn

Details for d1rb7b_

PDB Entry: 1rb7, 2.1 Å

PDB Description: Yeast cytosine deaminase crystal form p212121 with sodium acetate.

PDB Compounds: (B:) Cytosine deaminase

SCOP Domain Sequences for d1rb7b_:

Sequence; same for both SEQRES and ATOM records:

>d1rb7b_ c.97.1.2 (B:) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
askwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkgsatlhgeis
tlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgekylqtrg
hevvvvdderckkimkqfiderpqdwfedige

Timeline for d1rb7b_:

• d1rb7b_ first appeared in SCOP 1.67
  
• d1rb7b_ appears in SCOP 1.71
  
• d1rb7b_ appears in SCOP 1.75
  
• d1rb7b_ appears in the current release, SCOPe 2.08