PDB entry 1rb7

View 1rb7 on RCSB PDB site
Description: Yeast cytosine deaminase crystal form p212121 with sodium acetate.
Class: hydrolase
Keywords: cytosine deaminase, streak seeding, amino hydrolase, zinc bound
Deposited on 2003-11-02, released 2004-03-02
The last revision prior to the SCOP 1.73 freeze date was dated 2004-03-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.185
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytosine deaminase
    Species: Saccharomyces cerevisiae
    Gene: FCY1, YPR062W, YP9499.17
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rb7a_
  • Chain 'B':
    Compound: Cytosine deaminase
    Species: Saccharomyces cerevisiae
    Gene: FCY1, YPR062W, YP9499.17
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rb7b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rb7A (A:)
    gssmvtggmaskwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkg
    satlhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfksk
    gekylqtrghevvvvdderckkimkqfiderpqdwfedige
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rb7A (A:)
    askwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkgsatlhgeis
    tlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgekylqtrg
    hevvvvdderckkimkqfiderpqdwfedige
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rb7B (B:)
    gssmvtggmaskwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkg
    satlhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfksk
    gekylqtrghevvvvdderckkimkqfiderpqdwfedige
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rb7B (B:)
    askwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkgsatlhgeis
    tlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgekylqtrg
    hevvvvdderckkimkqfiderpqdwfedige