Lineage for d1rb4a_ (1rb4 A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039471Superfamily h.1.3: Leucine zipper domain [57959] (2 families) (S)
  5. 3039472Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)
  6. 3039540Protein GCN4 [57961] (2 species)
  7. 3039541Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (65 PDB entries)
    Uniprot P03069 249-279 ! Uniprot P03069 249-281
  8. 3039726Domain d1rb4a_: 1rb4 A: [97268]
    trimeric mutant
    mutant

Details for d1rb4a_

PDB Entry: 1rb4 (more details), 1.9 Å

PDB Description: antiparallel trimer of gcn4-leucine zipper core mutant as n16a tetragonal automatic solution
PDB Compounds: (A:) General control protein GCN4

SCOPe Domain Sequences for d1rb4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rb4a_ h.1.3.1 (A:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rmkqledkveellskayhlenevarlkklv

SCOPe Domain Coordinates for d1rb4a_:

Click to download the PDB-style file with coordinates for d1rb4a_.
(The format of our PDB-style files is described here.)

Timeline for d1rb4a_: