SCOPe 2.06: Domain d1r8ub_: 1r8u B:

Lineage for d1r8ub_ (1r8u B:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.53: TAZ domain [57932] (1 superfamily)
   all-alpha fold; Zn-binding sites are in the loops connecting helices

4. Superfamily g.53.1: TAZ domain [57933] (1 family)
   automatically mapped to Pfam PF02135

5. Family g.53.1.1: TAZ domain [57934] (2 proteins)

6. Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57936] (6 PDB entries)

8. Domain d1r8ub_: 1r8u B: [97250]
   Other proteins in same PDB: d1r8ua_
   CH1 (TAZ1) domain; complexed with Cited2 transactivation domain (chain A)
   complexed with zn

Details for d1r8ub_

PDB Entry: 1r8u

PDB Description: nmr structure of cbp taz1/cited2 complex

PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d1r8ub_:

Sequence; same for both SEQRES and ATOM records:

>d1r8ub_ g.53.1.1 (B:) CREB-binding transcriptional adaptor protein CBP (p300) {Mouse (Mus musculus) [TaxId: 10090]}
atgptadpekrkliqqqlvlllhahkcqrreqangevracslphcrtmknvlnhmthcqa
gkacqvahcassrqiishwknctrhdcpvclplknasdkr

Timeline for d1r8ub_:

• d1r8ub_ first appeared in SCOP 1.67
  
• d1r8ub_ appears in SCOPe 2.05
  
• d1r8ub_ appears in SCOPe 2.07
  
• d1r8ub_ appears in the current release, SCOPe 2.08