SCOPe 2.02: Domain d1r89a1: 1r89 A:143-257

Lineage for d1r89a1 (1r89 A:143-257)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (5 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein)

6. Protein tRNA nucleotidyltransferase, second domain [101275] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [101276] (28 PDB entries)
   Uniprot O28126

8. Domain d1r89a1: 1r89 A:143-257 [97221]
   Other proteins in same PDB: d1r89a2, d1r89a3
   complexed with cl, ctp, mg, mn, na

Details for d1r89a1

PDB Entry: 1r89, 1.8 Å

PDB Description: Crystal Structures of an Archaeal Class I CCA-Adding Enzyme and Its Nucleotide Complexes

PDB Compounds: (A:) tRNA nucleotidyltransferase

SCOPe Domain Sequences for d1r89a1:

Sequence; same for both SEQRES and ATOM records:

>d1r89a1 a.160.1.3 (A:143-257) tRNA nucleotidyltransferase, second domain {Archaeoglobus fulgidus [TaxId: 2234]}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk

Timeline for d1r89a1:

• d1r89a1 first appeared in SCOP 1.67
  
• d1r89a1 appears in SCOPe 2.01
  
• d1r89a1 appears in SCOPe 2.03
  
• d1r89a1 appears in the current release, SCOPe 2.08