Lineage for d1r6ta1 (1r6t A:7-60)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909017Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 909018Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 909108Family a.16.1.3: a tRNA synthase domain [47068] (2 proteins)
  6. 909115Protein N-terminal domain of eukaryotic tryptophanyl-tRNA synthetase (TrpRS) [101103] (1 species)
  7. 909116Species Human (Homo sapiens) [TaxId:9606] [101104] (1 PDB entry)
  8. 909117Domain d1r6ta1: 1r6t A:7-60 [97160]
    Other proteins in same PDB: d1r6ta2, d1r6tb_
    complexed with gol, tym

Details for d1r6ta1

PDB Entry: 1r6t (more details), 2.1 Å

PDB Description: crystal structure of human tryptophanyl-trna synthetase
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d1r6ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6ta1 a.16.1.3 (A:7-60) N-terminal domain of eukaryotic tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]}
asllelfnsiatqgelvrslkagnaskdeidsavkmlvslkmsykaaagedyka

SCOPe Domain Coordinates for d1r6ta1:

Click to download the PDB-style file with coordinates for d1r6ta1.
(The format of our PDB-style files is described here.)

Timeline for d1r6ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r6ta2
View in 3D
Domains from other chains:
(mouse over for more information)
d1r6tb_