Class a: All alpha proteins [46456] (284 folds) |
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) |
Family a.16.1.3: a tRNA synthase domain [47068] (2 proteins) |
Protein N-terminal domain of eukaryotic tryptophanyl-tRNA synthetase (TrpRS) [101103] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101104] (1 PDB entry) |
Domain d1r6ta1: 1r6t A:7-60 [97160] Other proteins in same PDB: d1r6ta2, d1r6tb_ complexed with gol, tym |
PDB Entry: 1r6t (more details), 2.1 Å
SCOPe Domain Sequences for d1r6ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r6ta1 a.16.1.3 (A:7-60) N-terminal domain of eukaryotic tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]} asllelfnsiatqgelvrslkagnaskdeidsavkmlvslkmsykaaagedyka
Timeline for d1r6ta1: