Lineage for d1r5cb_ (1r5c B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1015692Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1015693Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1015694Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1015968Protein Seminal ribonucleasease [54086] (1 species)
  7. 1015969Species Cow (Bos taurus) [TaxId:9913] [54087] (15 PDB entries)
    Uniprot P00669 27-150
  8. 1015977Domain d1r5cb_: 1r5c B: [97084]
    complexed with cpa

Details for d1r5cb_

PDB Entry: 1r5c (more details), 2.1 Å

PDB Description: X-ray structure of the complex of Bovine seminal ribonuclease swapping dimer with d(CpA)
PDB Compounds: (B:) Ribonuclease, seminal

SCOPe Domain Sequences for d1r5cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5cb_ d.5.1.1 (B:) Seminal ribonucleasease {Cow (Bos taurus) [TaxId: 9913]}
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

SCOPe Domain Coordinates for d1r5cb_:

Click to download the PDB-style file with coordinates for d1r5cb_.
(The format of our PDB-style files is described here.)

Timeline for d1r5cb_: