Lineage for d1r5ca_ (1r5c A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 851941Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 851942Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulfide-rich
  5. 851943Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 852228Protein Seminal ribonucleasease [54086] (1 species)
  7. 852229Species Cow (Bos taurus) [TaxId:9913] [54087] (12 PDB entries)
    Uniprot P00669 27-150
  8. 852236Domain d1r5ca_: 1r5c A: [97083]

Details for d1r5ca_

PDB Entry: 1r5c (more details), 2.1 Å

PDB Description: X-ray structure of the complex of Bovine seminal ribonuclease swapping dimer with d(CpA)
PDB Compounds: (A:) Ribonuclease, seminal

SCOP Domain Sequences for d1r5ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5ca_ d.5.1.1 (A:) Seminal ribonucleasease {Cow (Bos taurus) [TaxId: 9913]}
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

SCOP Domain Coordinates for d1r5ca_:

Click to download the PDB-style file with coordinates for d1r5ca_.
(The format of our PDB-style files is described here.)

Timeline for d1r5ca_: