PDB entry 1r5c

View 1r5c on RCSB PDB site
Description: X-ray structure of the complex of Bovine seminal ribonuclease swapping dimer with d(CpA)
Class: hydrolase
Keywords: ribonucleases, protein dynamics, protein structure-function, x-ray diffraction, ligand binding, population shift, 3D domain swapping
Deposited on 2003-10-10, released 2004-04-13
The last revision prior to the SCOP 1.75 freeze date was dated 2004-04-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease, seminal
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1r5ca_
  • Chain 'B':
    Compound: Ribonuclease, seminal
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1r5cb_
  • Heterogens: CPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1r5cA (A:)
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1r5cB (B:)
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv