SCOP 1.69: Domain d1r5aa2: 1r5a A:2-86

Lineage for d1r5aa2 (1r5a A:2-86)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (15 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Class delta GST [81366] (5 species)
   formerly a part of class theta enzymes

7. Species Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId:123217] [102439] (1 PDB entry)

8. Domain d1r5aa2: 1r5a A:2-86 [97082]
   Other proteins in same PDB: d1r5aa1

Details for d1r5aa2

PDB Entry: 1r5a, 2.5 Å

PDB Description: Glutathione S-transferase

SCOP Domain Sequences for d1r5aa2:

Sequence; same for both SEQRES and ATOM records:

>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5}
ttvlyylpasppcrsvlllakmigveldlkvlnimegeqlkpdfvelnpqhciptmddhg
lvlwesrvilsylvsaygkdenlyp

Timeline for d1r5aa2:

• d1r5aa2 first appeared in SCOP 1.67
  
• d1r5aa2 appears in SCOP 1.71
  
• d1r5aa2 appears in the current release, SCOPe 2.08