SCOP 1.67: Domain d1r5aa1: 1r5a A:87-215

Lineage for d1r5aa1 (1r5a A:87-215)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class delta GST [81355] (5 species)
   formerly a part of class theta enzymes

7. Species Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId:123217] [101207] (1 PDB entry)

8. Domain d1r5aa1: 1r5a A:87-215 [97081]
   Other proteins in same PDB: d1r5aa2
   complexed with cu, gts

Details for d1r5aa1

PDB Entry: 1r5a, 2.5 Å

PDB Description: Glutathione S-transferase

SCOP Domain Sequences for d1r5aa1:

Sequence; same for both SEQRES and ATOM records:

>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5}
kdfrsraivdqrlhfdlgtlyqrvvdyyfptihlgahldqtkkaklaealgwfeamlkqy
qwsaanhftiadialcvtvsqieafqfdlhpyprvrawllkckdeleghgykeinetgae
tlaglfrsk

Timeline for d1r5aa1:

• d1r5aa1 is new in SCOP 1.67
  
• d1r5aa1 appears in SCOP 1.69
  
• d1r5aa1 appears in the current release, SCOPe 2.08