Lineage for d1r4va_ (1r4v A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764835Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 764836Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 765239Family a.22.1.4: Bacterial histone-fold protein [101318] (2 proteins)
    duplication: two repeats of histone fold are arranged as subunits in the archael histone dimer; new structure from Thermus thermophilus (1wws) comprised of dimers similar the to the H3-H4 tetramer
  6. 765240Protein Hypothetical protein Aq_328 [101319] (1 species)
  7. 765241Species Aquifex aeolicus [TaxId:63363] [101320] (1 PDB entry)
  8. 765242Domain d1r4va_: 1r4v A: [97049]
    structural genomics
    complexed with cac, zn

Details for d1r4va_

PDB Entry: 1r4v (more details), 1.9 Å

PDB Description: 1.9A crystal structure of protein AQ328 from Aquifex aeolicus
PDB Compounds: (A:) Hypothetical protein AQ_328

SCOP Domain Sequences for d1r4va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4va_ a.22.1.4 (A:) Hypothetical protein Aq_328 {Aquifex aeolicus [TaxId: 63363]}
etmlrpkgfdkldhyfrteldidltdetielllnsvkaafgklfygaeqrarwngrdfia
ladlnitkaleehiknfqkieqdmgvdelleyiafippvemnvgedlkseyrnimgglll
mhadvikkatgerkpsreamefvaqivdkvf

SCOP Domain Coordinates for d1r4va_:

Click to download the PDB-style file with coordinates for d1r4va_.
(The format of our PDB-style files is described here.)

Timeline for d1r4va_: