Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.4: Bacterial histone-fold protein [101318] (2 proteins) duplication: two repeats of histone fold are arranged as subunits in the archael histone dimer; new structure from Thermus thermophilus (1wws) comprised of dimers similar the to the H3-H4 tetramer |
Protein Hypothetical protein Aq_328 [101319] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [101320] (1 PDB entry) |
Domain d1r4va_: 1r4v A: [97049] structural genomics complexed with cac, zn |
PDB Entry: 1r4v (more details), 1.9 Å
SCOP Domain Sequences for d1r4va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r4va_ a.22.1.4 (A:) Hypothetical protein Aq_328 {Aquifex aeolicus [TaxId: 63363]} etmlrpkgfdkldhyfrteldidltdetielllnsvkaafgklfygaeqrarwngrdfia ladlnitkaleehiknfqkieqdmgvdelleyiafippvemnvgedlkseyrnimgglll mhadvikkatgerkpsreamefvaqivdkvf
Timeline for d1r4va_: