Lineage for d1r4va_ (1r4v A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362511Fold a.197: Hypothetical protein Aq 328 [101316] (1 superfamily)
    core: 6 helices; one central helix is surrounded by 5 others
  4. 362512Superfamily a.197.1: Hypothetical protein Aq 328 [101317] (1 family) (S)
  5. 362513Family a.197.1.1: Hypothetical protein Aq 328 [101318] (1 protein)
  6. 362514Protein Hypothetical protein Aq_328 [101319] (1 species)
  7. 362515Species Aquifex aeolicus [TaxId:63363] [101320] (1 PDB entry)
  8. 362516Domain d1r4va_: 1r4v A: [97049]
    structural genomics
    complexed with cac, zn

Details for d1r4va_

PDB Entry: 1r4v (more details), 1.9 Å

PDB Description: 1.9A crystal structure of protein AQ328 from Aquifex aeolicus

SCOP Domain Sequences for d1r4va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4va_ a.197.1.1 (A:) Hypothetical protein Aq_328 {Aquifex aeolicus}
etmlrpkgfdkldhyfrteldidltdetielllnsvkaafgklfygaeqrarwngrdfia
ladlnitkaleehiknfqkieqdmgvdelleyiafippvemnvgedlkseyrnimgglll
mhadvikkatgerkpsreamefvaqivdkvf

SCOP Domain Coordinates for d1r4va_:

Click to download the PDB-style file with coordinates for d1r4va_.
(The format of our PDB-style files is described here.)

Timeline for d1r4va_: