Lineage for d1r4qe_ (1r4q E:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 949388Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 949389Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 949702Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 949811Species Shigella dysenteriae, toxin I [TaxId:622] [50212] (3 PDB entries)
    identical sequence with verotoxin-1 B
  8. 949820Domain d1r4qe_: 1r4q E: [97035]
    Other proteins in same PDB: d1r4qa_, d1r4ql_

Details for d1r4qe_

PDB Entry: 1r4q (more details), 2.5 Å

PDB Description: shiga toxin
PDB Compounds: (E:) Shigella toxin chain B

SCOPe Domain Sequences for d1r4qe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4qe_ b.40.2.1 (E:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin I [TaxId: 622]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOPe Domain Coordinates for d1r4qe_:

Click to download the PDB-style file with coordinates for d1r4qe_.
(The format of our PDB-style files is described here.)

Timeline for d1r4qe_: