Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species) phage-borne toxin; bacteriophages H30 and H19B |
Species Shigella dysenteriae, toxin I [TaxId:622] [50212] (3 PDB entries) identical sequence with verotoxin-1 B |
Domain d1r4qd_: 1r4q D: [97034] Other proteins in same PDB: d1r4qa_, d1r4ql_ |
PDB Entry: 1r4q (more details), 2.5 Å
SCOPe Domain Sequences for d1r4qd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r4qd_ b.40.2.1 (D:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin I [TaxId: 622]} tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng ggfsevifr
Timeline for d1r4qd_: