SCOPe 2.05: Domain d1r4pc_: 1r4p C:

Lineage for d1r4pc_ (1r4p C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
   phage-borne toxin; bacteriophages H30 and H19B

7. Species Shigella dysenteriae, toxin II [TaxId:622] [101755] (1 PDB entry)

8. Domain d1r4pc_: 1r4p C: [97027]
   Other proteins in same PDB: d1r4pa_
   complexed with 1ps, edo, fmt, na

Details for d1r4pc_

PDB Entry: 1r4p, 1.77 Å

PDB Description: shiga toxin type 2

PDB Compounds: (C:) shiga-like toxin type II B subunit

SCOPe Domain Sequences for d1r4pc_:

Sequence; same for both SEQRES and ATOM records:

>d1r4pc_ b.40.2.1 (C:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin II [TaxId: 622]}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
gfaevqfnnd

Timeline for d1r4pc_:

• d1r4pc_ first appeared in SCOP 1.67
  
• d1r4pc_ appears in SCOPe 2.04
  
• d1r4pc_ appears in SCOPe 2.06
  
• d1r4pc_ appears in the current release, SCOPe 2.08