SCOPe 2.05: Domain d1r46b1: 1r46 B:324-422

Lineage for d1r46b1 (1r46 B:324-422)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Melibiase [75020] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101919] (17 PDB entries)
   alpha-galactosidase A

8. Domain d1r46b1: 1r46 B:324-422 [96975]
   Other proteins in same PDB: d1r46a2, d1r46b2
   complexed with edo, nag

Details for d1r46b1

PDB Entry: 1r46, 3.25 Å

PDB Description: structure of human alpha-galactosidase

PDB Compounds: (B:) Alpha-galactosidase A

SCOPe Domain Sequences for d1r46b1:

Sequence; same for both SEQRES and ATOM records:

>d1r46b1 b.71.1.1 (B:324-422) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentmq

Timeline for d1r46b1:

• d1r46b1 first appeared in SCOP 1.67
  
• d1r46b1 appears in SCOPe 2.04
  
• d1r46b1 appears in SCOPe 2.06
  
• d1r46b1 appears in the current release, SCOPe 2.08