Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Protein Peptidase-like beta-alanine synthase [103003] (1 species) |
Species Yeast (Saccharomyces kluyveri) [TaxId:4934] [103004] (2 PDB entries) |
Domain d1r3ne2: 1r3n E:248-363 [96954] Other proteins in same PDB: d1r3na1, d1r3nb1, d1r3nc1, d1r3nd1, d1r3ne1, d1r3nf1, d1r3ng1, d1r3nh1 complexed with bib, zn |
PDB Entry: 1r3n (more details), 2.7 Å
SCOPe Domain Sequences for d1r3ne2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r3ne2 d.58.19.1 (E:248-363) Peptidase-like beta-alanine synthase {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} aynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpys vniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqvsp
Timeline for d1r3ne2: