Lineage for d1r2sa_ (1r2s A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473234Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 473235Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 473236Protein Triosephosphate isomerase [51353] (17 species)
  7. 473335Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [102035] (3 PDB entries)
  8. 473342Domain d1r2sa_: 1r2s A: [96879]

Details for d1r2sa_

PDB Entry: 1r2s (more details), 2.85 Å

PDB Description: crystal structure of rabbit muscle triosephosphate isomerase

SCOP Domain Sequences for d1r2sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2sa_ c.1.1.1 (A:) Triosephosphate isomerase {Rabbit (Oryctolagus cuniculus)}
psrkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkiav
aaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalsegl
gviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqa
qevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefv
diinakq

SCOP Domain Coordinates for d1r2sa_:

Click to download the PDB-style file with coordinates for d1r2sa_.
(The format of our PDB-style files is described here.)

Timeline for d1r2sa_: