SCOPe 2.08: Domain d1r2cl_: 1r2c L:

Lineage for d1r2cl_ (1r2c L:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (4 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81474] (21 PDB entries)

8. Domain d1r2cl_: 1r2c L: [96862]
   Other proteins in same PDB: d1r2cc_, d1r2ch1, d1r2ch2, d1r2cm_
   complexed with bcb, bpb, fe2, hem, lda, mq7, ns5, so4, uq2

Details for d1r2cl_

PDB Entry: 1r2c, 2.86 Å

PDB Description: photosynthetic reaction center blastochloris viridis (atcc)

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d1r2cl_:

Sequence; same for both SEQRES and ATOM records:

>d1r2cl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

Timeline for d1r2cl_:

• d1r2cl_ first appeared in SCOP 1.67
  
• d1r2cl_ appears in SCOPe 2.07