SCOP 1.71: Domain d1r27c1: 1r27 C:1075-1246

Lineage for d1r27c1 (1r27 C:1075-1246)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (3 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (9 proteins)
   molybdopterine enzyme

6. Protein Respiratory nitrate reductase 1 alpha chain [101828] (1 species)

7. Species Escherichia coli [TaxId:562] [101829] (3 PDB entries)

8. Domain d1r27c1: 1r27 C:1075-1246 [96851]
   Other proteins in same PDB: d1r27a2, d1r27b_, d1r27c2, d1r27d_
   complexed with f3s, fs4, mgd, mo

Details for d1r27c1

PDB Entry: 1r27, 2 Å

PDB Description: crystal structure of nargh complex

SCOP Domain Sequences for d1r27c1:

Sequence; same for both SEQRES and ATOM records:

>d1r27c1 b.52.2.2 (C:1075-1246) Respiratory nitrate reductase 1 alpha chain {Escherichia coli}
gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw
ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp
thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqesvk

Timeline for d1r27c1:

• d1r27c1 first appeared in SCOP 1.67
  
• d1r27c1 appears in SCOP 1.69
  
• d1r27c1 appears in SCOP 1.73
  
• d1r27c1 appears in the current release, SCOPe 2.08