Lineage for d1r27c1 (1r27 C:1075-1246)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 377990Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 378013Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 378034Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (8 proteins)
    molybdopterine enzyme
  6. 378082Protein Respiratory nitrate reductase 1 alpha chain [101828] (1 species)
  7. 378083Species Escherichia coli [TaxId:562] [101829] (2 PDB entries)
  8. 378086Domain d1r27c1: 1r27 C:1075-1246 [96851]
    Other proteins in same PDB: d1r27a2, d1r27b_, d1r27c2, d1r27d_
    complexed with f3s, fs4, mgd, mo

Details for d1r27c1

PDB Entry: 1r27 (more details), 2 Å

PDB Description: crystal structure of nargh complex

SCOP Domain Sequences for d1r27c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r27c1 b.52.2.2 (C:1075-1246) Respiratory nitrate reductase 1 alpha chain {Escherichia coli}
gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw
ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp
thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqesvk

SCOP Domain Coordinates for d1r27c1:

Click to download the PDB-style file with coordinates for d1r27c1.
(The format of our PDB-style files is described here.)

Timeline for d1r27c1: