![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein Surfactant protein, lectin domain [56461] (2 species) |
![]() | Species Rat (Rattus norvegicus), SP-A [TaxId:10116] [103352] (2 PDB entries) |
![]() | Domain d1r14a1: 1r14 A:110-228 [96784] Other proteins in same PDB: d1r14a2 complexed with mes, sm |
PDB Entry: 1r14 (more details), 2.5 Å
SCOPe Domain Sequences for d1r14a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r14a1 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Rat (Rattus norvegicus), SP-A [TaxId: 10116]} smlsvgdkvfstngqsvnfdtikemctraggniavprtpeeneaiasiakkynnyvylgm iedqtpgdfhyldgasvsytnwypgeprgqgkekcvemytdgtwndrgclqyrlavcef
Timeline for d1r14a1: