Lineage for d1r0ob_ (1r0o B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262247Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2262248Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2262272Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. Protein Ecdysone receptor DNA-binding domain [103601] (1 species)
  7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [103602] (2 PDB entries)
  8. 2262279Domain d1r0ob_: 1r0o B: [96733]
    Other proteins in same PDB: d1r0oa_
    protein/DNA complex; complexed with zn

Details for d1r0ob_

PDB Entry: 1r0o (more details), 2.24 Å

PDB Description: Crystal Structure of the Heterodimeric Ecdysone Receptor DNA-binding Complex
PDB Compounds: (B:) Ecdysone receptor

SCOPe Domain Sequences for d1r0ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0ob_ g.39.1.2 (B:) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
eelclvcgdrasgyhynaltcegckgffrrsvtksavycckfgracemdmymrrkcqecr
lkkclavgmrpecvvpen

SCOPe Domain Coordinates for d1r0ob_:

Click to download the PDB-style file with coordinates for d1r0ob_.
(The format of our PDB-style files is described here.)

Timeline for d1r0ob_: