SCOP 1.69: Domain d1qzxb3: 1qzx B:88-294

Lineage for d1qzxb3 (1qzx B:88-294)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (11 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [102373] (2 PDB entries)

8. Domain d1qzxb3: 1qzx B:88-294 [96716]
   Other proteins in same PDB: d1qzxa1, d1qzxa2, d1qzxb1, d1qzxb2

Details for d1qzxb3

PDB Entry: 1qzx, 4 Å

PDB Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication

SCOP Domain Sequences for d1qzxb3:

Sequence; same for both SEQRES and ATOM records:

>d1qzxb3 c.37.1.10 (B:88-294) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Sulfolobus solfataricus}
pnvnptklpfiimlvgvqgsgktttagklayfykkrgykvglvaadvyrpaaydqllqlg
nqigvqvygepnnqnpieiakkgvdifvknkmdiiivdtagrhgygeetklleemkemyd
vlkpddvilvidasigqkaydlasrfhqaspigsviitkmdgtakgggalsavvatgati
kfigtgekideletfnakrfvsrilgm

Timeline for d1qzxb3:

• d1qzxb3 first appeared in SCOP 1.67
  
• d1qzxb3 appears in SCOP 1.71
  
• d1qzxb3 appears in the current release, SCOPe 2.08