Lineage for d1qzxa2 (1qzx A:295-432)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442435Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
    4 helices; orthogonal array
  4. 442436Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family) (S)
  5. 442437Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)
  6. 442438Protein Signal sequence binding protein Ffh [47448] (3 species)
  7. 442439Species Archaeon Sulfolobus solfataricus [TaxId:2287] [101170] (2 PDB entries)
  8. 442440Domain d1qzxa2: 1qzx A:295-432 [96712]
    Other proteins in same PDB: d1qzxa1, d1qzxa3, d1qzxb1, d1qzxb3

Details for d1qzxa2

PDB Entry: 1qzx (more details), 4 Å

PDB Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication

SCOP Domain Sequences for d1qzxa2:

Sequence, based on SEQRES records: (download)

>d1qzxa2 a.36.1.1 (A:295-432) Signal sequence binding protein Ffh {Archaeon Sulfolobus solfataricus}
gdiesilekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhipg
lgimlptpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveev
rellewynnmnrllkmvk

Sequence, based on observed residues (ATOM records): (download)

>d1qzxa2 a.36.1.1 (A:295-432) Signal sequence binding protein Ffh {Archaeon Sulfolobus solfataricus}
gdiesilekvkgleeydkiqkkmedltlrdvyaqiialrkmgplskvlqhipglgimlpt
psedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveevrellewy
nnmnrllkmvk

SCOP Domain Coordinates for d1qzxa2:

Click to download the PDB-style file with coordinates for d1qzxa2.
(The format of our PDB-style files is described here.)

Timeline for d1qzxa2: