Lineage for d1qzwg2 (1qzw G:295-432)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640568Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
    4 helices; orthogonal array
  4. 640569Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family) (S)
  5. 640570Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)
  6. 640571Protein Signal sequence binding protein Ffh [47448] (3 species)
  7. 640572Species Archaeon Sulfolobus solfataricus [TaxId:2287] [101170] (2 PDB entries)
  8. 640578Domain d1qzwg2: 1qzw G:295-432 [96709]
    Other proteins in same PDB: d1qzwa1, d1qzwa3, d1qzwc1, d1qzwc3, d1qzwe1, d1qzwe3, d1qzwg1, d1qzwg3
    complexed with ccc, gtp

Details for d1qzwg2

PDB Entry: 1qzw (more details), 4.1 Å

PDB Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication
PDB Compounds: (G:) signal recognition 54 kda protein

SCOP Domain Sequences for d1qzwg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzwg2 a.36.1.1 (G:295-432) Signal sequence binding protein Ffh {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
gdiesilekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhipg
lgimlptpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveev
rellewynnmnrllkmvk

SCOP Domain Coordinates for d1qzwg2:

Click to download the PDB-style file with coordinates for d1qzwg2.
(The format of our PDB-style files is described here.)

Timeline for d1qzwg2: