SCOP 1.73: Domain d1qzwc1: 1qzw C:1-87

Lineage for d1qzwc1 (1qzw C:1-87)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (3 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [101121] (2 PDB entries)

8. Domain d1qzwc1: 1qzw C:1-87 [96702]
   Other proteins in same PDB: d1qzwa2, d1qzwa3, d1qzwc2, d1qzwc3, d1qzwe2, d1qzwe3, d1qzwg2, d1qzwg3

Details for d1qzwc1

PDB Entry: 1qzw, 4.1 Å

PDB Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication

PDB Compounds: (C:) signal recognition 54 kda protein

SCOP Domain Sequences for d1qzwc1:

Sequence; same for both SEQRES and ATOM records:

>d1qzwc1 a.24.13.1 (C:1-87) Signal sequence recognition protein Ffh {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
mlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakikerlnkekp
psvlerkewfisivydelsklfggdke

Timeline for d1qzwc1:

• d1qzwc1 first appeared in SCOP 1.67
  
• d1qzwc1 appears in SCOP 1.71
  
• d1qzwc1 appears in SCOP 1.75
  
• d1qzwc1 appears in the current release, SCOPe 2.08